PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G2133
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 367aa    MW: 40357.7 Da    PI: 7.5535
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G2133genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.3e-32200255156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W++eLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Gh_A13G2133 200 KQRRCWSSELHKRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 255
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.248197257IPR017930Myb domain
SuperFamilySSF466893.98E-18198258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-28198258IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-27200255IPR006447Myb domain, plants
PfamPF002493.3E-7202253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MDYAQKMRKC HEYVEALEEE RRKIQVFQRE LPLCFELVTQ AIESCKKEMY MQGQSECSEQ  60
TSSDSPVLEE FIPIKRSCNC SEEDDDDDDE NVAAADKKKS DWLRSVQLWN PPSKEDVGKT  120
GSGVQMKGNG GAFQPFHKEK GNVEKKSVEA VGKGNASATA TTTTSASTTE SGSRGIAADD  180
GNTNKKVEKG QQQQQPPQRK QRRCWSSELH KRFLHALQQL GGSHVATPKQ IRELMKVDGL  240
TNDEVKSHLQ KYRLHTRRPS PSINSNGNNP QTPQFVVVGG IWVPPQEYAS VATTAVVSGE  300
TSVTPSPNSG VYAPVAVPLP TLAKPSVQRL QRSQSEDRGS HSEGRVHSNS PSTSSSTHTT  360
TDGFPAF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.95870.0boll| ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO783293180.0
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465287.10.0PREDICTED: uncharacterized protein LOC105784055
TrEMBLA0A0D2SAH50.0A0A0D2SAH5_G
STRINGVIT_01s0011g03110.t011e-132(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.12e-86G2-like family protein